8 Studying Hominids In ac t i v i t y 5, Using Fossil Evidence to Investigate Whale Evolution, you
|
|
- Jasper Allen
- 5 years ago
- Views:
Transcription
1 8 Studying Hominids In ac t i v i t y 5, Using Fossil Evidence to Investigate Whale Evolution, you were working with evidence for the evolution of the whale lineage. A lineage is a series of populations of a single species or several species descended from a common ancestor. On an evolutionary tree a branch represents a lineage. lamprey frog bird whale Each line shown on this tree for vertebrates is a lineage. The evolution of another lineage supported by a growing body of evidence is the one that led to humans. In this activity, you will examine some of the evidence about the species that make up hominids, which include humans and apes. A Neanderthal fossil skeleton. 459
2 Science & Global Issues/Biology evolution Challenge 00How do biologists study the evolutionary relationships of hominids? Materials For each group of four students set of six Cranium Diagrams For each pair of students metric ruler protractor sticky notes For each student Student Sheet 8.1, Cranium Comparisons Student Sheet 3.1, Ideas about Evolution, from Activity 3 Student Sheet 3.2, Geologic Time and Major Events, from Activity 3 Procedure Part A: Physical Evidence for Human Ancestry 1. With your group, compare the six cranium diagrams. Record in your science notebook similarities and differences you observe. 2. Group the six organisms according to how closely related you think they are based on the similarities and differences you recorded in Step 1. Write your groupings in your science notebook. 3. Obtain Student Sheet 8.1, Cranium Comparisons. Observe the characteristics shown on the chart, and record the information in the appropriate column. Measure lengths with a ruler, and measure angles with a protractor. Note: Diagrams 1, 2, and 3 already show the lines you will measure. For diagrams 4, 5, and 6 you will need to draw the lines that you will then measure. The skeleton of Lucy provides evidence about the evolution of the human lineage. 460
3 studying hominids Activity 8 4. Examine your observations from Step 3. Record any patterns in the data that suggest changes over time. 5. Complete the reading, Natural Selection in the Human Lineage, on the following pages to learn more about the ape and human lineages. As you read, follow the and Take Note strategy, using the sticky notes as you did in previous activities. 6. Based on your data and the information in the reading, what conclusions can you draw about the relationships between the six species? Part B: Molecular Evidence for Human Ancestry 7. The box below shows a portion of the amino acid sequence for hemoglobin in humans, chimpanzees, and gorillas. Sketch a tree hypothesis suggested by the amino acid data and the information you gathered in Part A. Label the root of the tree common ancestor. Amino Acid Sequence Data h u m a n M V H LT P E E K S AV TA LW G K V N V D E V G G E A L G R L LV V Y P W T Q R F F E S F G D L S T P D AV M G N P K V K A H G K K V L G A F S D GLAHLDNLKGTFATLSELHCDKLHVDPEN F RLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH c h i m p a n z e e M V H LT P E E K S AV TA LW G K V N V D E V G G E A L G R L LV V Y P W T Q R F F E S F G D L S T P D AV M G N P K V K A H G K K V L G A F S D GLAHLDNLKGTFATLSELHCDKLHVDPEN F RLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH g o r i l l a M V H LT P E E K S AV TA LW G K V N V D E V G G E A L G R L LV V Y P W T Q R F F E S F G D L S T P D AV M G N P K V K A H G K K V L G A F S D GLAHLDNLKGTFATLSELHCDKLHVDPEN K RLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH 8. Go back to the statements on Student Sheet 3.1, Ideas about Evolution, from Activity 3. Record on it information from this activity to support whether any of the statements is correct or incorrect. 9. Go back to the geologic timeline you constructed in Activity 3, Geologic Time. On Student Sheet 3.2, Geologic Time and Major Events, record the origin of hominins (humans and their extinct bipedal ancestors). 461
4 Science & Global Issues/Biology evolution Analysis 1. Suppose you analyzed the DNA sequences for a number of DNA segments in humans, chimpanzees, and gorillas, and you collected the data in the table below: DNA Sequences in Humans, Chimpanzees, and Gorillas DNA comparison Sequence difference (%) Human chimpanzee 1.24 Human gorilla 1.62 Chimpanzee gorilla 1.63 Explain how these data are related to the amino acid data from Part B and how they explain the evolutionary relationship between humans, chimps, and gorillas. 2. Based on the portion of the hominid tree from Procedure Step 7, how would you respond to someone who claims that a. scientific evidence suggests that humans descended from chimps and gorillas? b. scientific evidence suggests that humans, gorillas, and chimpanzees share an evolutionary ancestor? 3. How does the scientific process you followed in this activity reflect the way that scientists ask and answer questions about the natural world? Key vocabulary evidence evolutionary tree hominid lineage 462
5 studying hominids Activity 8 reading Natural Selection in the Human Lineage m o d e r n h u m a n s (Homo sapiens) are classified as members of the family Hominidae, as are gorillas and chimpanzees. Evidence suggests that the human and chimpanzee lineages split approximately 5 million years ago as shown in the tree below. Scientists are still gathering evidence that would allow them to reconstruct the early history of the hominids. The fossil and DNA data they have collected, however, suggest that the adaptation for walking upright on two legs (bipedalism) defines the divergence of the human lineage. The chart above summarizes the locomotion methods for the six hominid species that you are investigating in this activity. Locomotion Methods for Six Hominid Species Species Gorilla gorilla (gorilla) Pan troglodytes (chimpanzee) Australopithecines boisei ( Lucy, extinct) Homo erectus (extinct) Homo neanderthalensis ( Neanderthal, extinct) Homo sapiens (modern humans) There are several physical characters that allow for full-time upright walking in humans: Humans have larger vertebrae to carry the weight of the upper body. The point at which the spinal cord enters the skull is near the center of the cranium, Locomotion Knuckle walking most of the time and bipedal walking for short distances Knuckle walking most of the time and bipedal walking for short distances which allows the head to balance on top of the spine. The human pelvis is positioned for greater balance while walking. The structure of the human foot includes a weight- bearing platform and a shock-absorbing arch. (Continued on next page) tree hypothesis for primates HoMinoidS lemurs new World monkeys monkeys orangutan gibbon gorilla HoMinidS human chimp 5 mya 2 mya 35 mya 463
6 Science & Global Issues/Biology evolution (Continued from previous page) As new fossil and DNA evidence is discovered, scientists evaluate hypotheses for the evolution of bipedalism by natural selection. There is evidence to suggest that early hominins (living humans and extinct bipedal ancestors) had both the character for bipedal motion and the character in quadrupeds (taxa with four-legged locomotion) for grasping when moving in trees. A 4.4 million-year-old fossil, called Ardi, had features for walking on two legs on the ground and grasping when moving in the trees. Ardi s pelvis was structured to support large hind limb muscles for climbing, resulting in a walk without the side-to-side gait of a chimpanzee. Ardi had big toes spread out from the rest for climbing, like those of an ape. She had an additional bone inside a tendon in the big toes that made them more rigid, and suitable for walking. These characters, which indicate Ardi was capable of foraging in the grasslands and climbing trees, provide clues about the evolution of bipedal ism and the environment in which the human lineage might have evolved. Additional evidence will help scientists understand more clearly the factors that led to the divergence of the human lineage from its ancestors. n 464
Human Evolution - Skull Analysis
Name: Date: Human Evolution - Skull Analysis Prior Knowledge Questions (Do these BEFORE using the Gizmo.) 1. Label one of the skulls below as human and the other as a chimpanzee skull. 2. What features
More informationHomework. Guided Reading Hominids Through Time (#12-21)
Homework Guided Reading Hominids Through Time (#12-21) Learning Target I can explain how hominids evolved and what caused them to evolve. What characteristics do they have in common? What characteristics
More informationHominid Skull Comparisons
Hominid Skull Comparisons Visit the following website: www.humanorigins.si.edu/evidence/human-family-tree Explore the interactive Human Family Tree. What can you conclude about the evolution of humans
More informationOutline. Evolution: Human Evolution. Primates reflect a treedwelling. Key Concepts:
Evolution: Human Evolution Primates reflect a treedwelling heritage Outline 1. Key concepts 2. Characteristics of primates 3. Prosimians and anthropoids 4. The first hominids: Ardipithecus 5. The first
More informationPrimate Evolution. Section 1. Primates
Section 1 Primates Characteristics of Primates! Manual dexterity! Five digits on each hand and foot! Flat nails and sensitive areas on the ends of their digits! The first digits are opposable. Section
More informationTHE EARLIEST HUMANS. Student Handouts, Inc.
THE EARLIEST HUMANS Student Handouts, Inc. HOMINID EVOLUTION Hominids = great apes Chimpanzees, gorillas, humans, and orangutans Numerous intermediary fossils have been found But scientists disagree on
More informationStudent Exploration: Human Evolution - Skull Analysis
Name: Date: Student Exploration: Human Evolution - Skull Analysis Prior Knowledge Questions 1. Label one of the skulls below as human and the other as a chimpanzee skull. 2. What features did you use to
More informationHuman Ancestry (Learning Objectives)
Human Ancestry (Learning Objectives) 1. Identify the characters shared by all primates and relate them to the function they served in their common ancestor. 2. Learn the fields study of Human evolution
More information4/20/2008. Overview. Early Human Evolution. Chronology of Hominid Evolution. Overview of Species. Epochs of the Cenozoic Era
Early Human Evolution Overview and Chronology What makes us human? Ardipithecus and early Australopithecus Robust and gracile australopithecines Oldowan tools Overview First hominins appeared late in the
More information1. Primate evolution provides a context for understanding human origins
1. Primate evolution provides a context for understanding human origins Primates are monkeys, lemurs, tarsiers and apes (including us!). Compared to other mammals Most primates have hands and feet adapted
More informationChapter 17: Human Evolution
Chapter 17: Human Evolution Classification Hierarchy Kingdom Phylum Class Order Family Genus Species Animal Chordate Mammal Primates Hominids Homo Sapiens Important Vocabulary Scientist who studies fossil
More informationNOTES: Ch 34 - Mammals & Primate / Human Evolution ( )
NOTES: Ch 34 - Mammals & Primate / Human Evolution (34.7-34.8) Class: MAMMALIA Mammals possess unique derived characteristics: 1) Provide young with milk (mammary glands) 2) Internal fertilization; some
More informationStudy Guide Primates and Human Evolution. Where do you fit into the natural world? Characteristics of Primates
Study Guide Primates and Human Evolution Describe the traits of primates.! Classify yourself taxonomically.! What traits make you human?! Describe the evolutionary trends in hominin species over the past
More informationStudent Wrap-up. Topic: Investigating Hominoid Fossils: Evidence of Evolution
Student Wrap-up Topic: Investigating Hominoid Fossils: Evidence of Evolution Benchmark: SC.912.L.15.10 Identify basic trends in hominid evolution from early ancestors six million years ago to modern humans,
More informationInvestigating Hominoid Fossils Laboratory
Biology I Unit V: Zoology Chapter 25-28 & DOL: Vertebrates Investigating Hominoid Fossils Laboratory Name: Date: Hour: Investigating Hominoid Fossils Laboratory Pre-Lab Discussion Because hominoid fossils
More informationBipedalism. Bipedalism - on two feet. The single most distinctive feature of Hominids. Hominid bipedalism is habitual and required
Bipedalism Bipedalism Bipedalism - on two feet. The single most distinctive feature of Hominids Hominid bipedalism is habitual and required Body Changes: knuckle walkers vs. bipedalists Body Changes: knuckle
More informationBuild Vocabulary Students will have a more successful lab experience if they understand these terms.
Guided Inquiry Forensics Lab hapter 26 Lab Investigating Hominoid Fossils Problem What can a comparison of skulls and hands reveal about the evolution of humans? Introduction paleontologist takes photographs
More informationBIOL 1010 Introduction to Biology: The Evolution and Diversity of Life. Spring 2011 Sections A & B
BIOL 1010 Introduction to Biology: The Evolution and Diversity of Life. Spring 2011 Sections A & B Steve Thompson: stthompson@valdosta.edu http://www.bioinfo4u.net 1 Human evolution where we came from
More informationMammals Grew 1,000 Times Larger After the Demise of the Dinosaurs
Mammals Grew 1,000 Times Larger After the Demise of the Dinosaurs The largest land mammals that ever lived, Indricotherium and Deinotherium, would have towered over the living African Elephant. Indricotherium
More informationIntroduction to Biological Anthropology: Notes 21 Apes and early hominins Copyright Bruce Owen 2011 the first known hominoids (apes) appeared in the
Introduction to Biological Anthropology: Notes 21 Apes and early hominins Copyright Bruce Owen 2011 the first known hominoids (apes) appeared in the late Oligocene, 27 mya example Oligocene ape: genus
More information12/1/14. Speciation and Human Evolution. The Time Course of Speciation. Speciation Rates
Speciation and Human Evolution References: chapters 24 (first few slides) 34 (last few pages of chapter) Speciation can occur rapidly or slowly, and can result from changes in few or many genes Many questions
More informationEARLY HUMANS COMPARE AND CONTRAST CHART
Name: KEY Period: Date: World History Mrs. Schenck Early Human/ Nickname Ardipithecus ramidus Ardi Where they lived/ When Where: Eastern Africa (Ethiopia) When: 4.4 million years ago Very apelike, hairy
More informationThe Human Animal. The Human Timescale. Geological Timescale. Millions of Years. Periods Jurassic. Major events
The Human Animal The Human Timescale Geological Timescale Millions of Years Periods Permian Triassic Jurassic Cretaceous Tertiary Quat. Major events Dinosaurs Evolve and Expand Start of Age of Reptiles
More informationThe Human Animal. The Human Timescale. Geological Timescale. Millions of Years. Periods Permian Triassic Jurassic Cretaceous Tertiary Quat.
The Human Animal 1 The Human Timescale 2 Geological Timescale Millions of Years Periods Permian Triassic Jurassic Cretaceous Tertiary Quat. Major events Start of Age of Reptiles Dinosaurs Evolve and Expand
More informationThe Human Animal. Species. The Human Timescale. Geological Timescale. Primate Evolution Primate Ancestor
The Human Animal The Human Timescale 1 2 Geological Timescale Species Millions of Years Periods Permian Triassic Jurassic Cretaceous Tertiary Quat. Major events Dinosaurs Evolve and Expand Start of Age
More information2010-2014 www.d.umn.edu/cla/faculty/troufs/anthfood/aftexts.html#title 2010-2014 www.d.umn.edu/cla/faculty/troufs/anthfood/aftexts.html#title 2010-2014 www.d.umn.edu/cla/faculty/troufs/anthfood/aftexts.html#title
More informationBIO 182 LAB SIGN OFF PAGE LESSON 10
BIO 182 LAB SIGN OFF PAGE LESSON 10 Name Please staple all of your lab pages for this Lesson together with this page as the top. You will use this page to get your Labs for Lesson 10 signed off by the
More informationBipedalism and Tool Making. And the fascinating history of the extended phenotype
Bipedalism and Tool Making And the fascinating history of the extended phenotype What exactly does it mean for big toes to be abductible (opposable)? I was wondering how scientists were able to distinguish
More informationEvolution-Human Evolution. Biology: Fezza Miami Arts Charter
EvolutionHuman Evolution Biology: Fezza Miami Arts Charter Biogeography the study of the distribution of species and ecosystems in geographic space and through (geological) time Evolution is modification
More informationHistory matters: - personal basis - group basis
Human Evolution History matters: - personal basis - group basis HISTORY GEOGRAPHY/CONTEXT humanity The recognition of the power of context and history motivates creationists Their concern: If we accept
More information1. Use the diagrams below to investigate the pelvis and scapula models and identify anatomical structures. Articulated Pelvis
LSO Pelvis/Scapula Activity Activity 1: Pelvis and Scapula Anatomy 1. Use the diagrams below to investigate the pelvis and scapula models and identify anatomical structures. Articulated Pelvis (anterior
More informationAnthro 101: Human Biological Evolution. Lecture 13: Early Hominins. Prof. Kenneth Feldmeier
Anthro 101: Human Biological Evolution Lecture 13: Early Hominins Prof. Kenneth Feldmeier Biological Anthropology Hominoid = Apes Humans, Gorillas, Chimpanzees, Orangutans, Gibbons and Siamangs Hominin
More informationHuman evolution. Fascinating subject - where did we come from? History of Primates:
Human evolution. Fascinating subject - where did we come from? History of Primates: - evolved from shrews during Cretaceous (so an older order) about 65 mya. - Some characteristics of primates: - clavicle
More informationChapter 14: PRIMATE EVOLUTION
Chapter 14: PRIMATE EVOLUTION PRIMATES What is a primate? Features that are unique to primates: -Present in primates -Absent in closely related groups Outgroup Ingroup Character A present Character A absent
More informationInternet Assignment: Early Hominids
ANTHRO 1-L: Biological Anthropology Lab R. Mitchell, Instructor Name: Internet Assignment: Early Hominids From the late Miocene (10-5.5 mya) to the early Pliocene (5.5-4 mya), a major adaptive shift was
More informationClavicle well developed (allows increase flexibility, supports arms). Five digits, front and rear. Often thumb (and big toe) opposable.
Human evolution. It d be nice to spend some time with some other groups (e.g. dinosaurs), but this just isn t possible in a survey course like this. BUT, we will spend a little time on human evolution!
More informationCenozoic Climates. Human Evolution and Adaptation
Cenozoic Climates Human Evolution and Adaptation Life Styles of the Merely Hominid Miocene Climates Miocene Habitats The increase in climate variability would have been evident in many regions as increased
More informationHominid! Evolution: On The Origin of Humans
What is a Hominid? Hominid! Evolution: On The Origin of Humans The term hominid is also used in the more restricted sense as hominins Humans and relatives of humans closer than chimpanzees Bipedal Modern
More informationShort Film Great Transitions: The Origin of Humans IN-DEPTH FILM GUIDE
DESCRIPTION IN-DEPTH FILM GUIDE Paleontologists have studied the fossil record of human evolution just as they have done for that of other major transitions including the transition from fish to tetrapods
More informationIntroduction to Biological Anthropology: Notes 17 The first hominins Copyright Bruce Owen 2008 Last time we saw how apes radiated (diversified) in
Introduction to Biological Anthropology: Notes 17 The first hominins Copyright Bruce Owen 2008 Last time we saw how apes radiated (diversified) in the middle Miocene some shifted from quadrupedal to more
More informationOur own species, Homo sapiens, belongs to the order that also
32 3 Primates and Human Origins Section 32 3 Our own species, Homo sapiens, belongs to the order that also includes lemurs, monkeys, and apes. Carolus Linnaeus named our order Primates, which means first
More informationPrimates : mammal order with about 185 spp. (out of 4500 mammal species) Primates. Sister order = tree shrews? (order Scandentia)
Primates : mammal order with about 185 spp. (out of 4500 mammal species) bonnet macaque squirrel monkey Primates - largely tree-dwelling (arboreal) and tropical Sister order = tree shrews? (order Scandentia)
More informationHuman Evolution: One Step at a Time. Objectives
TEACHER GUIDE Human Evolution: One Step at a Time 60-Minute Life Science Lesson Interactive Video Conferencing Grades: 6-12 Human Evolution: One Step at a Time Description Trace the development of modern
More informationLecture 10-1 Early Fossil Hominids: Bipedal Anatomy & Pre- Australopithecines and Australopithecines
Lecture 10-1 Early Fossil Hominids: Bipedal Anatomy & Pre- Australopithecines and Australopithecines Big Questions 1. What is a hominid? 2. Why did hominids evolve from an apelike primate? 3. Who were
More informationAnthro 101: Human Biological Evolution. Lecture 13: Early Hominins. Prof. Kenneth Feldmeier
Anthro 101: Human Biological Evolution Lecture 13: Early Hominins Prof. Kenneth Feldmeier Biological Anthropology Hominoid = Apes Orangutan Humans, Gorillas, Chimpanzees, Orangutans, Gibbons and Siamangs
More informationNew fossil discoveries complicate the already devilish task of identifying HUMAN EVOLUTION Scientific American
HUMAN EVOLUTION SHATTERED New fossil discoveries complicate the already devilish task of identifying 42 Scientific American, February 2013 ANCESTRY our most ancient progenitors By Katherine Harmon liest
More informationREMEMBER YOU WILL NOT BE ABLE TO ANSWER THE QUESTIONS ABOUT ISLAND BIOGEOGRAPHY UNTIL AFTER THE 12/1 LECTURE
REMEMBER YOU WILL NOT BE ABLE TO ANSWER THE QUESTIONS ABOUT ISLAND BIOGEOGRAPHY UNTIL AFTER THE 12/1 LECTURE Answers to Practice questions week 14 and 15 (Answers are in BOLD): 1) The above is the generally
More informationCenozoic Climates. Hominid Origins
Cenozoic Climates First Prosimians Hominid Origins Ecology, Changing Social Patterns, and Bipedalism Anthropoids Hominids Miocene Climates Miocene Habitats The increase in climate variability would have
More informationHominins ultimately distinguished by brain size, bipedal locomotion and toolmaking behavior
Early Hominins Hominins ultimately distinguished by brain size, bipedal locomotion and toolmaking behavior But these did not develop simultaneously: mosaic evolution The only reliable indicator of earliest
More informationCHAPTER 9: HOMININ ORIGINS (PGS.
Learning Objectives Explain the general time depth for the earliest primates and explain how they may (or not) be related to living primates Define what a hominin is and explain what sort of evidence is
More informationWhere Do We Come From? An Introduction to Primate Biology GK-12 Inquiry Science Lesson Kristin De Lucia Fall 2002
Where Do We Come From? An Introduction to Primate Biology GK-12 Inquiry Science Lesson Kristin De Lucia Fall 2002 Background: This lesson is designed to correspond with units on human anatomy, especially
More informationComparing Indexes Among Primates
CHAPTER 12 ADDITIONAL INVESTIGATION Comparing Indexes Among Primates Background Humans have the largest brains of all primates. In order to accommodate this large brain, the skull of a human has a vertical
More informationA n t h r o p o l o g y
A n t h r o p o l o g y Appreciating Human Diversity Fifteenth Edition Conrad Phillip Kottak University of Michigan McGraw-Hill 2013 McGraw-Hill Companies. All Rights Reserved. C H A P T E R EARLY HOMININS
More informationOverview of Hominin Evolution
Overview of Hominin Evolution Lead Editor: Jessica Rothman, Katy Gonder, Holly Dunsworth, Kieran McNulty BIOLOGICAL ANTHROPOLOGY By: Herman Pontzer (Dept. of Anthropology, Hunter College; New York Consortium
More informationIntroduction to Biological Anthropology: Notes 20 Apes and early hominins Copyright Bruce Owen 2010 the first known hominoids (apes) appeared in the
Introduction to Biological Anthropology: Notes 20 Apes and early hominins Copyright Bruce Owen 2010 the first known hominoids (apes) appeared in the late Oligocene, 27 mya example Oligocene ape: genus
More informationVERTEBRATE EVOLUTION & DIVERSITY
VERTEBRATE EVOLUTION & DIVERSITY 1 ANIMAL DIVERSITY No true tissues Ancestral protist True tissues Radial symmetry True Animals Bilateral symmetry Bilateral Animals Deuterostomes Lophotrochophores Ecdysozoans
More informationAnimals II: The Chordates
Animals II: The Chordates Phylum : Chordata Subphylum: Urochordata: Tunicates Cephalochordata: Lancelets Vertebrata: Vertebrates Chordate Characteristics Bilaterally symmetrical, coelomate animals Complete
More informationWho Was Hunter Eve? Activity Subject: Gathering evidence, analyzing patterns Grade Level: 7 12 grades
Who Was Hunter Eve? Video Titles: Whitey Hagedorn, Paleontologist: Traces of Early Animal Life Flatworms: The First Hunter (from the beginning to 5:10) Activity Subject: Gathering evidence, analyzing patterns
More informationThe Mystery of the Skulls What Old Bones Can Tell Us About Hominins
Cornell Institute for Biology Teachers Copyright CIBT This work may be copied by the original recipient from CIBT to provide copies for users working under the direction of the original recipient. All
More informationLecture Human Evolution
Lecture Human Evolution I. Although modern human behavior is almost totally learned and cultural, it rests on a biological basis A. The processes of human evolution shaped humans brain and body 1. Accurate
More informationThe search for Adam's ancestors
341 by Elaine Kennedy : 12 E volutionary biologists are convinced that humans are descendants of ape-like creatures. n spite of a number of disputes over theories of apehuman lineages, paleoanthropologists
More informationLevel 3 Biology, 2017
91606 916060 3SUPERVISOR S Level 3 Biology, 2017 91606 Demonstrate understanding of trends in human evolution 9.30 a.m. Thursday 16 November 2017 Credits: Four Achievement Achievement with Merit Achievement
More informationAssessment Schedule 2015 Biology: Demonstrate understanding of trends in human evolution (91606) Evidence
NCEA Level 3 Biology (91606) 2015 page 1 of 6 Assessment Schedule 2015 Biology: Demonstrate understanding of trends in human evolution (91606) Evidence Q Evidence Achievement Merit Excellence ONE Accept
More informationWhat do the Bones tell us?
What do the Bones tell us? The scientific study of bones. Comes from the Greek word Osteon, meaning bone Sub-discipline of archaeology and physical anthropology, anatomy, forensics etc. Age at death Height/stature
More informationChapter 2 Human Origins: 7 Million to 1.9 Million Years Ago
Chapter Overview Chapter 2 Human Origins: 7 Million to 1.9 Million Years Ago The chapter begins with a description of the Pleistocene epoch, which is also known as the Great Ice Age or the Ice Age. The
More informationAnthro 101: Human Biological Evolution. Lecture 13: Early Hominins. Prof. Kenneth Feldmeier
Anthro 101: Human Biological Evolution Lecture 13: Early Hominins Prof. Kenneth Feldmeier Biological Anthropology Hominoid = Apes Humans, Gorillas, Chimpanzees, Orangutans, Gibbons Orangutan and Siamangs
More informationScience Tear Sheet #4. Human Evolution: The Story, the Legend, and the Myth
Science Tear Sheet #4. Human Evolution: The Story, the Legend, and the Myth The man who pleads his case first seems to be in the right; then his opponent comes and puts him to the test. Proverbs 18:17
More informationFoot biomechanics. Stephan F.E. Praet, MD PhD
MOVEFIT Foot biomechanics from an evolutionary perspective Stephan F.E. Praet, MD PhD Sports & exercise physician MoveFIT-Sports Medicine Dept. Rehabilitation Medicine Erasmus University Medical Centre,
More informationPrimate Evolution. Why It s Important Humans are primates. A knowledge of primates and their evolution can provide an understanding
Primate Evolution What You ll Learn You will compare and contrast primates and their adaptations. You will analyze the evidence for the ancestry of humans. Why It s Important Humans are primates. A knowledge
More informationProject Description Form
COTLOW FIELD RESEARCH FUND Department of Anthropology The George Washington University Washington, DC 20052 Project Description Form Applicant: Nicole L. Griffin Title of Project: Hominid Forefoot Kinematics,
More informationAP Biology - Zimmerman Guided Reading Chapter 34
AP Biology - Zimmerman Guided Reading Chapter 34 1. List the four characteristics of the members of the Phylum Chordata. Name 1. 2. 3. 4. 2. Define the following terms: a. notochord b. Dorsal nerve cord
More informationThe Toledo Zoo/ThinkingWorks. Teacher Overview for the Primate Lessons
The Toledo Zoo/ThinkingWorks Teacher Overview for the Primate Lessons Teacher Overview: Primates Primates have many traits that are unique to this particular order of animals. Below is a list of general
More informationThe Origin and Evolution of Human Communication: If We Were Walking the Walk, Were We Walking the Talk?
La Salle University La Salle University Digital Commons Explorer Café Explorer Connection 9-26-2018 The Origin and Evolution of Human Communication: If We Were Walking the Walk, Were We Walking the Talk?
More information2/17/2017. Lec. 11: Ch. 32 Deuterostomes
1 2 3 4 5 6 7 8 Lec. 11: Ch. 32 Deuterostomes Deuterostomes Radial cleavage Indeterminant blastomeres Blastopore becomes anus Coelom forms by outpouching of the gut (enterocoelous) Phylum Echinodermata
More informationSession 16: Episode 5(1) Introducing Episode 5, our ancient ancestors and their relatives
Session 16: Episode 5(1) Introducing Episode 5, our ancient ancestors and their relatives William P. Hall President Kororoit Institute Proponents and Supporters Assoc., Inc. - http://kororoit.org william-hall@bigpond.com
More informationHuman Evolution Chris Stringer The Natural History Museum London. Are we nearly there yet?
Human Evolution Chris Stringer The Natural History Museum London Are we nearly there yet? Phases of human evolution Human phase 2 0 Ma: >>Global spread Human anatomy >>Encephalised >>Dietary range >>Behavioural
More informationA New Kind of Ancestor: Ardipithecus Unveiled
A New Kind of Ancestor: Ardipithecus Unveiled The oldest known hominin skeleton reveals the body plan of our very early ancestors and the upright origins of humankind Every day, scientists add new pages
More informationCOMMON PRIMATE TRAITS
WHAT DO YOU MEAN THAT LOOKING AT ME MAKES YOU UNDERSTAND HOW APES, MONKEYS, AND HUMANS MUST HAVE SHARED A COMMON ANCESTOR AT SOME POINT IN TIME? COMMON PRIMATE TRAITS PHYSICAL FEATURES ARBOREAL (TREE-LIVING)
More informationHuman Hunting Evolved as an Adaptated Result of Arboreal Locomotion Model of Two-arm Brachiation (Π) C.Fang 1, T.Jiang 2
Human Hunting Evolved as an Adaptated Result of Arboreal Locomotion Model of Two-arm Brachiation (Π) C.Fang 1, T.Jiang 2 1 Department of Engineering Mechanics, Chongqing University, Chongqing, 400044,
More informationDevelopment Team. Physical/Biological Anthropology. Anthropology. Principal Investigator. Paper Coordinator. Content Writer.
Paper No. : 01 Physical/ Biological Module : 15 Development Team Principal Investigator Prof. Anup Kumar Kapoor Department of, University of Delhi Paper Coordinator Prof. Subho Roy Department of,university
More informationLevel 3 Biology, 2011
90719 907190 3SUPERVISOR S Level 3 Biology, 2011 90719 Describe trends in human evolution 2.00 pm uesday Tuesday 1 November 2011 Credits: Three Check that the National Student Number (NSN) on your admission
More informationThe First Humans. Hominids are the family of mankind and his or her relatives. Written by Lin Donn Illustrated by Phillip Martin
The First Humans Hominids are the family of mankind and his or her relatives. Written by Lin Donn Illustrated by Phillip Martin 65 Million Years Ago Dinosaurs died out about 65 million years ago. The first
More informationPage 1 of 9. Website: Mobile:
Question 1: Explain antibiotic resistance observed in bacteria in light of Darwinian selection theory. Darwinian selection theory states that individuals with favourable variations are better adapted than
More informationOutline 15: Paleozoic Life
Outline 15: Paleozoic Life The Evolution of Vertebrates: Fish and Amphibians Phylum Chordata All chordates have a dorsal nerve cord. Chordates with vertebrae are the vertebrates. The vertebrae surround
More informationOutline 15: Paleozoic Life. The Evolution of Vertebrates: Fish and Amphibians
Outline 15: Paleozoic Life The Evolution of Vertebrates: Fish and Amphibians Phylum Chordata All chordates have a dorsal nerve cord. Chordates with vertebrae are the vertebrates. The vertebrae surround
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature17654 Contents Supplementary Text S1. Calculating Locomotor Costs Supplementary Table 1. Estimated ranging costs for humans and other hominoids Supplementary Text S2. Estimating the Costs
More informationThe Stickleback Fish - A Story of Modern Evolution
The Stickleback Fish - A Story of Modern Evolution This activity uses a virtual lab created by HHMI Biointeractive. To complete this activity students will need a computer with an internet connection and
More informationRunning head: Origins of Bipedalism 1. Origins of Bipedalism. Kwang Hyun Ko. Hanyang University Research
Running head: Origins of Bipedalism 1 Origins of Bipedalism Kwang Hyun Ko Hanyang University Research Author s note Correspondence concerning this article should be addressed to Hanyang University Tel:
More informationLecture 2 Phylogenetics of Fishes. 1. Phylogenetic systematics. 2. General fish evolution. 3. Molecular systematics & Genetic approaches
Lecture 2 Phylogenetics of Fishes 1. Phylogenetic systematics 2. General fish evolution 3. Molecular systematics & Genetic approaches Charles Darwin & Alfred Russel Wallace All species are related through
More informationClass XII Chapter 7 Evolution Biology
Question 1: Explain antibiotic resistance observed in bacteria in light of Darwinian selection theory. Darwinian selection theory states that individuals with favourable variations are better adapted than
More informationAs we review the fossil evidence for early hominins, keep in mind the importance of identifying derived traits Ancestral traits are traits that have
As we review the fossil evidence for early hominins, keep in mind the importance of identifying derived traits Ancestral traits are traits that have not changed from the earlier ancestral form Derived
More informationThe First Humans. CHAPTER 1-Section 1. Written by Lin Donn Illustrated by Phillip Martin
The First Humans CHAPTER 1-Section 1 Written by Lin Donn Illustrated by Phillip Martin 65 Million Years Ago No matter what you may have seen in the movies, early man did not live during the same period
More informationBI 101: Chordate Animals & Biodiversity
BI 101: Chordate Animals & Biodiversity Final Exam tomorrow Announcements Same time, same place Review Mary s Peak biodiversity results Lab 10 today 1 Deuterostome Development 2 Phylum Chordata Contains
More informationUncovering Ardipithecus Ramidus
Uncovering Ardipithecus Ramidus Kristopher Jordan Krohn Mesa Community College/ Arizona State University 8 million years ago a tremendous even occurred; a new branch of primates split off from the chimpanzee
More informationABSTRACT A COMPARATIVE ANALYSIS OF PRIMATE FIRST METATARSALS: IMPLICATIONS FOR ARDIPITHECUS RAMIDUS
ABSTRACT A COMPARATIVE ANALYSIS OF PRIMATE FIRST METATARSALS: IMPLICATIONS FOR ARDIPITHECUS RAMIDUS Kristine Mitchell, M.A. Department of Anthropology Northern Illinois University, 2014 Daniel Gebo, Director
More informationThe Origin of Humans. DVD Lesson Plan
The Origin of Humans DVD Lesson Plan Purpose of the DVD The purpose of the DVD is to demonstrate that the credibility of the claims for transitional fossils between ape-like creatures and humans is very
More informationMeet the New Human Family
Meet the New Human Family Once we shared the planet with other human species, competing with them and interbreeding with them. Today we stand alone, but our rivals genes live on inside us even as their
More informationWalking the walk: evolution of human bipedalism
LOCOMOTOR ECOLOGY & BIOMECHANICS LAB Walking the walk: evolution of human bipedalism Susannah KS Thorpe S.K.Thorpe@bham.ac.uk Human walking is a risky business. Without split-second timing man would fall
More informationearly hominid fossils from AFRICA
ORIGINS MATT MAHURIN (illustration); ROBERT CAMPBELL (left); ALAN WALKER; NATIONAL MUSEUMS OF KENYA (center and right) early hominid fossils from AFRICA The year was 1965. Bryan Patterson, a paleoanthropologist
More informationDOWNLOAD OR READ : COMPARING LIMB STRUCTURE AND FUNCTION ANSWERS PDF EBOOK EPUB MOBI
DOWNLOAD OR READ : COMPARING LIMB STRUCTURE AND FUNCTION ANSWERS PDF EBOOK EPUB MOBI Page 1 Page 2 comparing limb structure and function answers comparing limb structure and pdf comparing limb structure
More information